Glyma18g12740 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g12740

Feature Type:	gene_model
Chromosome:	Gm18
Start:	12003023
stop:	12006628
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g12740

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G42910	AT	Annotation by Michelle Graham. TAIR10: Phosphoribosyltransferase family protein \| chr2:17856396-17858394 FORWARD LENGTH=337	SoyBase	E_val: 0	ISS
GO:0006783	GO-bp	Annotation by Michelle Graham. GO Biological Process: heme biosynthetic process	SoyBase	N/A	ISS
GO:0009116	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleoside metabolic process	SoyBase	N/A	ISS
GO:0009165	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0009220	GO-bp	Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0000287	GO-mf	Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding	SoyBase	N/A	ISS
GO:0004749	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ribose phosphate diphosphokinase activity	SoyBase	N/A	ISS
KOG1448	KOG	Ribose-phosphate pyrophosphokinase	JGI		ISS
PTHR10210	Panther	RIBOSE-PHOSPHATE PYROPHOSPHOKINASE	JGI		ISS
PF00156	PFAM	Phosphoribosyl transferase domain	JGI		ISS
UniRef100_G7K0V0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ribose-phosphate pyrophosphokinase n=1 Tax=Medicago truncatula RepID=G7K0V0_MEDTR	SoyBase	E_val: 0	ISS
UniRef100_UPI000233E408	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E408 related cluster n=1 Tax=unknown RepID=UPI000233E408	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma18g12740

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g12740

Paralog	Evidence	Comments
Glyma08g42220	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g12740 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g107000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g12740

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g12740

Limit To All Plant Sequences

>Glyma18g12740.1   sequence type=CDS   gene model=Glyma18g12740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAATGGTGAAGTCTCCCAATAAGCAAGTGAACCTCTTCTACTCCCTTGACTGCGAGGACCTTGCCCACAACGTTGCTCTTCAATCACCCAACATCATTCTCCAGAATATCAAATGGAGGTCATTTGCTGATGGATTTCCAAATATATATATAAATAATGCAGAAGAACTCCGAGGTCAACATGTTGCTTTCTTGGCATCTTTCAGCTCCCCTGCACATGTCTTTGAACAACTTTCTGTCATATATGCACTCCCTCGTTTATTTGTTGCTTCCTTCACATTGGTATTGCCTTTCTTTCCCACTGGATCCTTTGAGCGAATGGAGGAAGAAGGAGATGTAGCAACTGCCTTCACCCTTGCTAGGATGTTGTCAAATATTCCAATTTCTAGAGGTGGCCCAACTAGTTTAGTCATATATGACATTCATGCCTTGCAGGAGAGGTTTTATTTTGGAGATGAAGTCTTGCCCTTGTTTGAGACCGGTATTCCTCTCTTAAAGCAACGTCTGAGTCAGCTTCCCGACGCTGATAATGTAGTTATTGCATTTCCAGATGACGGTGCATGGAAGCGATTCCACAAGCAGTTTGATCATTTTTCACTGGTTGTATGTACTAAGGTTCGTGAAGGTGACAAGAGGATAGTTCGGCTCAAGGAAGGCAACGTCTCTGGTCATCATGTAGTCATTGTTGATGATTTGGTCCAATCTGGAGGCACCCTGATTGAGTGTCAGAAAGTTTTGGCAGCCAATGGTGCAGCAAAGGTGAGTGCCTATGTCACCCATGGCGTGTTCCCTAACCAATCATGGGAGCGATTCACTCATAAAAAAGACACCTTGGAGAATGCATTTGCCTACTTCTGGATCACAGATTCTTGCCCTCTTACTGTCAAAGCTATAGCAAATAAAGCTCCTTTTGAAGTGCTGAGTCTAGCCGGGTCTATTGCTAATGCTCTACAAATTTGA

Predicted protein sequences of Glyma18g12740

Limit To All Plant Sequences

>Glyma18g12740.1   sequence type=predicted peptide   gene model=Glyma18g12740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMVKSPNKQVNLFYSLDCEDLAHNVALQSPNIILQNIKWRSFADGFPNIYINNAEELRGQHVAFLASFSSPAHVFEQLSVIYALPRLFVASFTLVLPFFPTGSFERMEEEGDVATAFTLARMLSNIPISRGGPTSLVIYDIHALQERFYFGDEVLPLFETGIPLLKQRLSQLPDADNVVIAFPDDGAWKRFHKQFDHFSLVVCTKVREGDKRIVRLKEGNVSGHHVVIVDDLVQSGGTLIECQKVLAANGAAKVSAYVTHGVFPNQSWERFTHKKDTLENAFAYFWITDSCPLTVKAIANKAPFEVLSLAGSIANALQI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain